Designs

POST /v1/designs designs de-novo binders against a target with BoltzGen. It returns a job to poll, exactly like predictions. When it succeeds, the results hold the ranked designs.

Request

curl -s -X POST https://api.japanfold.com/v1/designs \
  -H 'Content-Type: application/json' \
  -d '{
    "protocol":"nanobody-anything",
    "name":"my-nanobodies",
    "spec":"sequences:\n  - protein: {id: A, sequence: MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQ}\n",
    "params":{"num_designs":10,"budget":10,"fast":true}
  }'

• spec (required): a YAML design spec, the target plus the binder request. Same YAML dialect as the Boltz/BoltzGen inputs.
• protocol: what to design (see below).
• name: optional label.
• params: see below.

Protocols

protocol	Designs
protein-anything	De-novo mini-protein binder against any target.
peptide-anything	Short peptide binder.
nanobody-anything	Single-domain antibody / nanobody (VHH).
antibody-anything	Antibody binder.
protein-small_molecule	Protein binder with a binding-affinity step.
protein-redesign	Re-design residues of an existing binder.

Parameters

Param	Type	Default	Range	Notes
num_designs	int	10	1–10	Binders to generate before filtering.
budget	int	10	1–10	Top ranked designs to keep after filtering.
fast	bool	true	-	Higher throughput, may be slightly less accurate.

(Free-tier ranges; see Models & limits.)

Submits accept the same Idempotency-Key and Prefer: wait headers as predictions. See Predictions.

Reading designs

Poll GET /v1/jobs/{id} until succeeded, then GET /v1/jobs/{id}/results. The results carry the ranked designs and downloadable structure artifacts; GET /v1/jobs/{id}/archive gives everything as one zip. See Jobs → Results. A full worked example is in Examples → Binder design.